PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K03133.2.p
Common NameEUGRSUZ_K03133, LOC104426469
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 560aa    MW: 61155.9 Da    PI: 7.614
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K03133.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.5e-1864110148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEde l +av+ + g++Wk+Ia++++  R++ qc +rwqk+l
  Eucgr.K03133.2.p  64 KGGWTPEEDETLRNAVAVYNGKSWKKIAEHFP-DRSEVQCLHRWQKVL 110
                       688*****************************.************986 PP

2Myb_DNA-binding61.81.4e-19116162148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd++++d+v ++G+  W++Ia+ ++ gR +kqc++rw+++l
  Eucgr.K03133.2.p 116 KGPWTQEEDDKIIDLVSRYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 162
                       79******************************.*************97 PP

3Myb_DNA-binding51.62.1e-16168211146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       + +WT eE++ l +a++  G++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.K03133.2.p 168 KEAWTLEEELALMQAHRVNGNK-WAEIAKVLP-GRTDNSIKNHWNS 211
                       579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.20359110IPR017930Myb domain
SuperFamilySSF466891.94E-1660117IPR009057Homeodomain-like
SMARTSM007171.4E-1563112IPR001005SANT/Myb domain
PfamPF002492.2E-1664110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2266125IPR009057Homeodomain-like
CDDcd001673.89E-1467110No hitNo description
PROSITE profilePS5129432.583111166IPR017930Myb domain
SuperFamilySSF466893.23E-31113209IPR009057Homeodomain-like
SMARTSM007177.7E-18115164IPR001005SANT/Myb domain
PfamPF002491.5E-18116162IPR001005SANT/Myb domain
CDDcd001674.76E-16118162No hitNo description
Gene3DG3DSA:1.10.10.609.3E-28126169IPR009057Homeodomain-like
SMARTSM007171.9E-15167215IPR001005SANT/Myb domain
PROSITE profilePS5129422.693167217IPR017930Myb domain
PfamPF002495.6E-15168211IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-23170217IPR009057Homeodomain-like
CDDcd001677.79E-12170213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MTVAGMAELK IEDCCLENRQ LTAASNSSLS EGSASATLKS PAVSSPATTS PSHRRTTGPI  60
RRAKGGWTPE EDETLRNAVA VYNGKSWKKI AEHFPDRSEV QCLHRWQKVL NPDLVKGPWT  120
QEEDDKIIDL VSRYGPTKWS LIAKSLPGRI GKQCRERWHN HLNPDIKKEA WTLEEELALM  180
QAHRVNGNKW AEIAKVLPGR TDNSIKNHWN SSLKKKLDFY LATGKLPPVA KSGLQNGSKD  240
ASKPTLAKRL VGCNKGANLN PQTSLGNGGT CKLEEENQDK LELMARHQEA CESSSILPSE  300
SADSGSAEFK SRIDVSSNLE VLAQSEDSGA CDKSDYKDVG TTPPEQALVY GFLCYEPPPL  360
ESCIPLDSEM NTHLLNQTCN SSPASPASFL TPPCERNGVF CTQSPESILR LAAETFPNTP  420
SILRKRKTQV AKHLFSNKTT KVDGEIVKDR VDSPDVGSNG SLEKSMSQNT SVYDSPCLSN  480
GASATMCNGG AFSASPPYRL RSKRTALLKS VEKQLDFTFE EMKLDGSTKS VDVPMKENVH  540
NAEGPSSHVT MISIQELKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-69632175159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-69632175159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K03133.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037835.10.0PREDICTED: transcription factor MYB51-like
TrEMBLA0A059A6860.0A0A059A686_EUCGR; Uncharacterized protein
TrEMBLA0A059A7920.0A0A059A792_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-143myb domain protein 3r-5